PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g46483.1.p
Common NameBRADI_2g46483
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 273aa    MW: 29896.6 Da    PI: 6.8585
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g46483.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM737.5e-23121388125
               NAM   8 hPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratk..sgyWkatgkdke 91 
                       hPt+ el++ yL +++++ +  ++  e+i+++d+y+++P +L +     ++  +e+ wyfFs+ ++k+ +g+rk r++k  +g W++   +k+
  Bradi2g46483.1.p  12 HPTELELIKSYLLPRITSGDdsNKSWEFIHHADVYTADPTSLTEmfppaRTIDGEEVWYFFSPVKTKSVHGQRKVRTVKsgAGCWHSEAGTKT 104
                       8**************9998855555578**************744676655557889*******************87734677********* PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmhe 125
                       v + +g+ vg ++ + f ++++ + ++t W+m e
  Bradi2g46483.1.p 105 VWDDRGHRVGHRQFFSFVTKEHGRRVRTGWLMVE 138
                       ******************9999999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.0495161IPR003441NAC domain
PfamPF023656.9E-1312138IPR003441NAC domain
SuperFamilySSF1019411.57E-3212161IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MITCPVVLSS RHPTELELIK SYLLPRITSG DDSNKSWEFI HHADVYTADP TSLTEMFPPA  60
RTIDGEEVWY FFSPVKTKSV HGQRKVRTVK SGAGCWHSEA GTKTVWDDRG HRVGHRQFFS  120
FVTKEHGRRV RTGWLMVELG IDNEHQVSRS SELVLCKIYM TPREASTPSK GLIDGVEEHM  180
PSKSSLSPSS PPSSSSPPAS PYSSPPSSPS SASPPSPTSS MSPSTPPLLS MSSLPALQKL  240
SSSLVVDDKE EGPTVLPESI NSAAMETIQQ PYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-131215927166NAC domain-containing protein 19
3swm_B3e-131215927166NAC domain-containing protein 19
3swm_C3e-131215927166NAC domain-containing protein 19
3swm_D3e-131215927166NAC domain-containing protein 19
3swp_A3e-131215927166NAC domain-containing protein 19
3swp_B3e-131215927166NAC domain-containing protein 19
3swp_C3e-131215927166NAC domain-containing protein 19
3swp_D3e-131215927166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754123.11e-122PREDICTED: NAC domain-containing protein 72-like
TrEMBLA0A0Q3GDB50.0A0A0Q3GDB5_BRADI; Uncharacterized protein (Fragment)
STRINGSi004703m1e-50(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Representative plantOGRP1201646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.29e-16NAC family protein